Anti-GIRK1 antibody GTX54831 from GeneTex

Description

GeneTex's Anti-GIRK1 antibody is a Rabbit Polyclonal antibody. The Anti-GIRK1 antibody was generated using potassium inwardly-rectifying channel, subfamily J, member 3, GIRK-1, GIRK1, Kcnf3, Kir3.1 as the antigen. The Anti-GIRK1 antibody from GeneTex is a Rabbit Polyclonal antibody to GIRK1. The Anti-GIRK1 antibody Recognizes Human, Mouse, Rat. The Anti-GIRK1 antibody has been validated for the following Applications: WB, ICC/IF, IP, IHC

Product Specs
ItemAnti-GIRK1 antibody
CompanyGeneTex
Price Pricing Info Supplier Page
Catalog NumberGTX54831
Quantity50 µl
ApplicationsWB, ICC/IF, IP, IHC
Concentration0.6mg/ml
Conjugate/TagUnconjugated
FormatPBS, 1% BSA, 0.05% Sodium azide
PurityDepleted of anti-GST antibodies by affinity chromatography on immobilized GST and purified by antigen-affinity chromatography
ReactivityHuman, Mouse, Rat
TargetGIRK1
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenGST fusion protein with sequence LQRISSVPGNSEEKLVSKT TKMLSDPMSQSVADLPPKLQKMAGGPTRMEGNLPAKLRKM NSDRFT, corresponding to residues 437-501 ( Intracellular, C-terminus) of mouse GIRK1 (Accession : P63250), (MW: 34 kDa.)
NCBI Full Gene Namepotassium inwardly-rectifying channel, subfamily J, member 3
NCBI Gene AliasesKcnj1, GIRK-1, Kcnf3, Kir3.1, potassium inwardly-rectifying channel, subfamily J, member 3, GIRK-1, GIRK1, Kcnf3, Kir3.1, GIRK1
ClonalityPolyclonal
Research AreaNeuroscience
Gene NameKcnj3
Molecular Weight57